The short version of glucose-dependent fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-04-16 and is reviewed periodically as new material appears.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1 (GLP-1), a hormone released from intestinal L-cells after food intake. The compound belongs to the incretin mimetic class and acts at GLP-1 receptors distributed across pancreatic, gastrointestinal, cardiovascular, and central nervous system tissues. Compared with native GLP-1, the molecule carries structural changes that extend its activity from minutes to roughly one week. It is studied for glycemic control in type 2 diabetes and for weight management, and its effects on cardiovascular and other outcomes remain active research areas.
Receptor binding triggers G protein signaling that raises intracellular cyclic AMP in pancreatic beta cells. Insulin release follows in a glucose-dependent manner, so secretion increases when blood glucose is elevated and diminishes when it is not. The same signaling suppresses glucagon release from alpha cells and slows gastric emptying, which blunts the post-meal glucose rise. In the brain, receptor activation in regions such as the arcuate nucleus is associated with reduced appetite and lower energy intake. How much each of these effects contributes to overall weight change is not fully settled.
Routine characterisation of the peptide relies on reversed-phase high-performance liquid chromatography, often paired with ultraviolet detection near 214 nanometres. Related substances such as deamidated, oxidised, and truncated sequences elute at characteristic positions and are quantified by area percentage. Electrospray ionisation mass spectrometry confirms the molecular mass and can resolve some closely related variants. Peptide mapping after enzymatic digestion provides sequence-level verification and is useful when a full identity profile is required. Method parameters such as column chemistry, gradient, and mobile-phase pH influence the separation and must be reported alongside results.
Material described as research-grade is not necessarily manufactured to pharmaceutical standards, and purity figures depend on the method used to obtain them. A certificate of analysis states the measured purity, the analytical technique, and the batch identifier, but the underlying data are not always included. Independent testing by a second laboratory is a common way to confirm identity and purity. Uncertainties remain about how storage history affects long-term stability, and about how well results from one laboratory transfer to another. Documentation of handling conditions supports comparison between batches.
| Property | Value | Notes |
|---|---|---|
| Chemical class | GLP-1 receptor agonist peptide | Mimics endogenous incretin signaling |
| Molecular mass | Approximately 4114 Da | Modified 31-amino-acid backbone |
| Appearance | White to off-white powder | Typical of lyophilized peptide material |
| Solubility | Soluble in water | Behavior depends on salt form and buffer |
| Elimination half-life | About one week | Supported by albumin binding and protease resistance |
Lyophilized semaglutide is typically stored at temperatures between minus 20 and minus 80 degrees Celsius for long-term preservation. Short-term storage at 2 to 8 degrees Celsius is common for working aliquots. Repeated freeze-thaw cycles can degrade the peptide and are usually avoided. The molecule is hygroscopic in its solid form, so containers should remain sealed with desiccant. Solutions are less stable than powders and are generally prepared fresh. Light exposure is limited because aromatic residues can undergo photo-oxidation.
Semaglutide dissolves readily in water and in aqueous buffers near neutral pH. Solubility decreases near the isoelectric point, where net charge is minimal. Common laboratory solvents include phosphate-buffered saline and dilute ammonium bicarbonate. Strongly acidic or basic conditions may accelerate hydrolysis. Working concentrations are usually prepared by diluting a concentrated stock. Vial surfaces can adsorb small amounts of peptide at low concentrations, so carrier proteins or low-binding tubes are sometimes used.
Reverse-phase high-performance liquid chromatography is the standard method for purity assessment, separating the peptide from truncated or oxidized variants. Mass spectrometry confirms molecular mass and detects modifications, while ultraviolet absorbance near 280 nanometers supports concentration measurement through tryptophan and tyrosine residues. Circular dichroism can indicate secondary structure, though the peptide is largely helical in solution, and ion-exchange chromatography resolves charge variants. Purity values above 95 percent are typical for research-grade material. Stability studies track degradation over time under defined conditions.
Quality control relies on pharmacopoeial monographs where they exist, combined with in-house specifications for identity, purity, water content, and counter-ion composition. Reference standards allow calibration across laboratories, although certified materials for every analogue are not universally obtainable. Batch records, chromatograms, and mass spectra form the documentation trail. Regulatory classification varies by jurisdiction and intended use, and research-grade material differs from pharmaceutical-grade material in testing scope. Analytical uncertainty is often expressed as relative standard deviation across replicate injections.
Lyophilised semaglutide is generally held at -20 °C or below, protected from light and moisture. Reconstituted solutions are typically kept at 2-8 °C and used within a defined window because degradation accumulates over time. Repeated freeze-thaw cycles are discouraged, since each cycle can promote aggregation and reduce monomeric content. Room-temperature stability of the solid has been examined in some studies but remains incompletely characterised for long durations, so cold storage is the conservative default for research material.
Degradation proceeds along several parallel routes. Deamidation of asparagine and glutamine residues generates charged variants that shift retention time in chromatographic analysis. Oxidation targets methionine and can be accelerated by trace metals or dissolved oxygen. Non-covalent aggregation produces dimers, oligomers, and larger species that are difficult to reverse. Isomerisation at aspartate residues is slower but measurable under thermal stress. The distribution among these pathways depends on pH, buffer composition, ionic strength, and the presence of excipients such as sugars or surfactants.
Putnam established the Legislative Reference Service (LRS) in 1914 as a separative administrative unit of the library. Based on the Progressive Era's philosophy of science to be used to solve problems, and modeled after successful research branches of state legislatures, the LRS would provide informed answers to Congressional research inquiries on almost any topic. Congress passed in 1925 an act allowing the Library of Congress to establish a trust fund board to accept donations and endowments, giving the library a role as a patron of the arts. The library received donations and endowments by such prominent wealthy individuals as John D. Rockefeller, James B. Wilbur, and Archer M. Huntington. Gertrude Clarke Whittall donated five Stradivarius violins to the library. Elizabeth Sprague Coolidge's donations paid for a concert hall to be constructed within the Library of Congress building and an honorarium established for the Music Division to pay live performers for concerts. A number of chairs and consultantships were established from the donations, the most well-known of which is the Poet Laureate Consultant. The library's expansion eventually filled the library's Main Building, although it used shelving expansions in 1910 and 1927. The library needed to expand into a new structure. Congress acquired nearby land in 1928 and approved construction of the Annex Building (later known as the John Adams Building) in 1930. Although delayed during the Depression years, it was completed in 1938 and opened to the public in 1939.
CO2 + OH− ⇌ HCO−3 A reaction similar to this is almost instantaneous with carbonic anhydrase. The structure of the active site in carbonic anhydrases is well known from a number of crystal structures. It consists of a zinc ion coordinated by three imidazole nitrogen atoms from three histidine units. The fourth coordination site is occupied by a water molecule. The coordination sphere of the zinc ion is approximately tetrahedral. The positively-charged zinc ion polarizes the coordinated water molecule, and nucleophilic attack by the negatively-charged hydroxide portion on carbon dioxide proceeds rapidly. The catalytic cycle produces the bicarbonate ion and the hydrogen ion as the equilibrium:
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
====== Naloxone distribution ====== Naloxone is a drug used to counter an overdose from the effect of opioids; for example, a heroin or morphine overdose. Naloxone displaces the opioid molecules from the brain's receptors and reverses the respiratory depression caused by an overdose within two to eight minutes. The World Health Organization (WHO) includes naloxone on their "List of Essential Medicines", and recommends its availability and utilization for the reversal of opioid overdoses. Formal programs in which the opioid inverse agonist drug naloxone is distributed have been trialled and implemented. Established programs distribute naloxone, as per WHO's minimum standards, to people who use substances and their peers, family members, police, prisons, and others. These treatment programs and harm reduction centres operate in Afghanistan, Australia, Canada, China, Germany, Georgia, Kazakhstan, Norway, Russia, Spain, Tajikistan, the United Kingdom (UK), the United States (US), Vietnam, India, Thailand, Kyrgyzstan, Denmark and Estonia. Many reviews of the literature support the effectiveness of naloxone based interventions in reducing overdose deaths where it is available at the time of the overdose event.
Sources: en.wikipedia.org
=== Examination === Digital rectal examination is when the doctor feels inside the patient's anal canal and rectum with a finger. Proctoscopy or anoscopy is when a tube with a light is inserted into the anal canal and used to examine the anal canal and rectum. Stool is ideally evacuated before the examination. The patient lies in the lateral decubitus position and strains as if attempting defecation ("bearing down"). These tests may detect IRP, but they are unreliable. In one report of 127 patients with constipation, using clinical examination it was possible to detect only 42% of cases of IRP that were detected with defecography. Likewise, clinical examination accurately diagnosed the absence of IRP in only 77% of individuals without IRP. Successful identification of IRP during clinical examination is dependent on the length of the intussusception segment. When the intussusception is longer, it is more likely to be detected, while shorter intussusceptions are harder to detect during clinical examination. Proctoscopy is also helpful to rule out other conditions which may be causing the symptoms e.g., anal stenosis, perianal fistula, proctitis, anal carcinoma, low rectal carcinoma, or a defect of anal sphincter complex.
Anne Ephrussi (born 15 September 1955 in Paris, France) is a French developmental and molecular biologist. Her research is focused on the study of post-transcriptional regulations such as mRNA localization and translation control in molecular biology as well as the establishment of polarity axes in cell and developmental biology. She is director of the EMBL International Centre for Advanced Training (EICAT) program at the European Molecular Biology Laboratory (EMBL) since 2005 and served as head of the Developmental Biology Unit from 2007 to 2021.
CAVE systems included multiple flat screen displays, typically at least three walls to surround the human player, and incorporated some type of tracking sensor system to match the images on the walls to what direction the player was looking. Early applications of CAVE system were game-based demonstrations, but the cost remained prohibitive for commercial deployment even through the 2010s. Around this same time in the 1990s, major innovations in real-time 3D graphics had been made across computer, console, and arcade video games, and with further improvements in affordable consumer technologies, arcade games began to decline as they could not compete with these innovations. Arcade game manufacturers instead focused on offering games that could not easily be replicated at home, which included the introduction of VR-based arcade games. For example, the Virtuality Group produced its Virtuality line of arcade games starting in the early 1990s that typically included a VR headset with head-tracking and other features. However, the cost and upkeep of these machines made it difficult to continue support for them. There remained strong interest from academics to explore what VR, along with augmented reality and other mixed reality systems, could bring to video games, through the 2000s, but these games were mostly prepared for research proof-of-concepts to demonstrate the interaction of VR hardware, software, and human motion rather than for commercial release, since hardware costs were still high.
Sources: en.wikipedia.org
Native GLP-1 is degraded within minutes by dipeptidyl peptidase-4 and cleared quickly. Semaglutide carries a position 8 substitution that blocks that cleavage and a fatty diacid chain that binds albumin. Together these changes extend its circulating half-life to about one week.
Yes. Stimulation of insulin secretion is glucose-dependent, meaning the effect is larger when blood glucose is high and minimal when it is normal. This property separates GLP-1 receptor agonists from agents that drive insulin release regardless of glucose level.
Receptor expression in hypothalamic and brainstem regions is well documented, and reduced energy intake is consistently observed. The relative contribution of central versus peripheral signaling to total weight change is still an open question addressed by ongoing research.
Different techniques detect different classes of impurities, so a single number does not describe a sample completely. Reversed-phase chromatography resolves related peptides well but can miss inorganic salts, while mass spectrometry confirms mass without quantifying everything present. Comparing results requires knowing which method was used and how it was validated.